CCDC59 Rabbit Polyclonal Antibody

CAT#: TA331982

Rabbit Polyclonal Anti-CCDC59 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CCDC59"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CCDC59 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC59. Synthetic peptide located within the following region: EPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name coiled-coil domain containing 59
Background CCDC59 is a component of the transcription complexes of the pulmonary surfactant-associated protein-B (SFTPB) and -C (SFTPC). It enhances homeobox protein Nkx-2.1-activated SFTPB and SFTPC promoter activities.
Synonyms BR22; HSPC128; TAP26
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Dog: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.