Germany
Japan
United Kingdom
China
USD 285.00
5 Days
Antibodies
View as table Download
USD 425.00
2 Weeks
Anti-CCL20 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 440.00
2 Weeks
Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Peptide with sequence from the internal region of Human CCL20 (NP_004582.1; NP_001123518.1) |
USD 375.00
5 Days
Macrophage Inflammatory Protein 3 alpha (CCL20) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Porcine |
| Immunogen | Peptide with sequence from the internal region of Human CCL20 (NP_004582.1; NP_001123518.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (92%). |
USD 530.00
5 Days
Rabbit polyclonal MIP-3 alpha antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human MIP-3a protein. |
Rabbit polyclonal MIP 3 alpha antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant mouse MIP-3a protein. |
USD 530.00
5 Days
Mouse monoclonal MIP-3a antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 540.00
5 Days
Mouse monoclonal Anti-Human MIP-3a (MOUSE) Biotin Conjugated antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rat monoclonal anti-MIP-3a antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rat monoclonal Anti-Mouse MIP-3a (RAT) Biotin Conjugated antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
USD 285.00
5 Days
Rabbit Polyclonal anti-Ccl20 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ccl20 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI |
USD 220.00
3 Weeks
CCL20 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-95 of human CCL20 (NP_001123518.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CCL20