Germany
Japan
United Kingdom
China
Rabbit Polyclonal CCN3 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-NOV Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NOV Antibody: synthetic peptide directed towards the middle region of human NOV. Synthetic peptide located within the following region: RNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN |
Rabbit Polyclonal Anti-NOV Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NOV Antibody: synthetic peptide directed towards the C terminal of human NOV. Synthetic peptide located within the following region: KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK |
Active filters
Target Symbol
- CCN3