CCN3 (NOV) Rabbit Polyclonal Antibody

CAT#: TA332127

Rabbit Polyclonal Anti-NOV Antibody

Product Images

WB Suggested Anti-NOV Antibody Titration: 1.25ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NOV Antibody: synthetic peptide directed towards the middle region of human NOV. Synthetic peptide located within the following region: RNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: nephroblastoma overexpressed
• Database Link:
  NP_002505
  Entrez Gene 4856 Human
  UniProt ID P48745
• Background: As an immediate-early protein, NOV is likely to play a role in cell growth regulation.
• Synonyms: CCN3; IBP-9; IGFBP-9; IGFBP9; NOVh
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Horse: 86%; Mouse: 86%; Yeast: 83%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Secreted Protein