Antibodies

View as table Download

Rabbit Polyclonal Anti-CENPQ Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENPQ antibody: synthetic peptide directed towards the N terminal of human CENPQ. Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL

Rabbit polyclonal anti-CENP-Q antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full-length human CENP-Q recombinant protein.

Carrier-free (BSA/glycerol-free) CENPQ mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications WB
Reactivities Human
Conjugation Unconjugated

CENPQ Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 131-268 of human CENPQ (NP_060602.2).
Modifications Unmodified

CENPQ mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications WB
Reactivities Human
Conjugation Unconjugated

CENPQ mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

CENPQ mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP