CENPQ Rabbit Polyclonal Antibody

CAT#: TA344925

Rabbit Polyclonal Anti-CENPQ Antibody - N-terminal region

Product Images

WB Suggested Anti-CENPQ Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

• 

  Host: Rabbit; Target Name: CENPQ; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CENPQ; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CENPQ; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CENPQ; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml; CENPQ is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Host: Rabbit; Target Name: CENPQ; Sample Tissue: Human 293T; Antibody Dilution: 1.0 ug/ml; CENPQ is supported by BioGPS gene expression data to be expressed in HEK293T

Show all 6 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CENPQ antibody: synthetic peptide directed towards the N terminal of human CENPQ. Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: centromere protein Q
• Database Link:
  NP_060602
  Entrez Gene 55166 Human
  UniProt ID Q7L2Z9
• Background: CENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).
• Synonyms: C6orf139; CENP-Q
• Note: Immunogen Sequence Homology: Human: 100%