Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-CERKL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CERKL Antibody: A synthesized peptide derived from human CERKL |
Antibodies
View as table Download
Rabbit polyclonal anti-CERKL antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CERKL. |
Rabbit Polyclonal Anti-CERKL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CERKL antibody: synthetic peptide directed towards the C terminal of human CERKL. Synthetic peptide located within the following region: ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV |
Rabbit Polyclonal Anti-CERKL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CERKL antibody: synthetic peptide directed towards the N terminal of human CERKL. Synthetic peptide located within the following region: TLDLINLSEDHCDIWFRQFKKILAGFPNRPKSLKILLNPQSHKKEATQVY |
Rabbit Polyclonal Anti-CERKL Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CERKL |
Rabbit Polyclonal Anti-CERKL Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CERKL |
CERKL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 359-558 of human CERKL (NP_001025482.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CERKL