CERKL Rabbit Polyclonal Antibody

CAT#: TA342754

Rabbit Polyclonal Anti-CERKL Antibody

Product Images

WB Suggested Anti-CERKL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CERKL antibody: synthetic peptide directed towards the C terminal of human CERKL. Synthetic peptide located within the following region: ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: ceramide kinase like
• Database Link:
  NP_001025482
  Entrez Gene 375298 Human
  UniProt ID Q49MI3
• Background: This gene was initially identified as a locus (RP26) associated with an autosomal recessive form of retinitis pigmentosa (arRP) disease. This gene encodes a protein with ceramide kinase-like domains, however, the protein does not phosphorylate ceramide and its target substrate is currently unknown. This protein may be a negative regulator of apoptosis in photoreceptor cells. Mutations in this gene cause a form of retinitis pigmentosa characterized by autosomal recessive cone and rod dystrophy (arCRD). Alternative splicing of this gene results in multiple transcript variants encoding different isoforms and non-coding transcripts.
• Synonyms: RP26
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 90%; Yeast: 89%; Rabbit: 81%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome