Goat Anti-LASS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KDLREYDTAEAQ, from the internal region of the protein sequence according to NP_067090.1; NP_937850.1. |
Goat Anti-LASS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KDLREYDTAEAQ, from the internal region of the protein sequence according to NP_067090.1; NP_937850.1. |
Rabbit Polyclonal Anti-CERS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CERS1 antibody: synthetic peptide directed towards the middle region of human CERS1. Synthetic peptide located within the following region: LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR |
Rabbit Polyclonal Anti-CERS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CERS1 |
CERS1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CERS1 |