Ceramide synthase 1 (CERS1) Rabbit Polyclonal Antibody

CAT#: TA338471

Rabbit Polyclonal Anti-CERS1 Antibody

Product Images

WB Suggested Anti-CERS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CERS1 antibody: synthetic peptide directed towards the middle region of human CERS1. Synthetic peptide located within the following region: LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: ceramide synthase 1
• Database Link:
  NP_067090
  Entrez Gene 10715 Human
  UniProt ID P27544
• Background: This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserv
• Synonyms: EPM8; LAG1; LASS1; UOG1
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%

Reference Data

• Protein Families: Druggable Genome