Rabbit Polyclonal Anti-CHRAC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRAC1 antibody: synthetic peptide directed towards the middle region of human CHRAC1. Synthetic peptide located within the following region: SETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS |
Rabbit polyclonal anti-CHRC1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHRC1. |
Rabbit Polyclonal Anti-CHRAC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CHRAC1 Antibody: synthetic peptide directed towards the N terminal of human CHRAC1. Synthetic peptide located within the following region: SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSE |
CHRAC1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRAC1 |
CHRAC1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1). |
| Modifications | Unmodified |
CHRAC1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China