CHRAC1 Rabbit Polyclonal Antibody
Other products for "CHRAC1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CHRAC1 Antibody: synthetic peptide directed towards the N terminal of human CHRAC1. Synthetic peptide located within the following region: SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 15 kDa |
Gene Name | chromatin accessibility complex 1 |
Database Link | |
Background | CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. [supplied by OMIM] |
Synonyms | CHARC1; CHARC15; CHRAC-1; CHRAC-15; CHRAC15; YCL1 |
Note | Immunogen sequence homology: Human: 100%; Rat: 92%; Horse: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Mouse: 85%; Guinea pig: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.