Antibodies

View as table Download

Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor beta2 (extracellular)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EDFDNMKKVRLP, corresponding to amino acid residues 96-107 of rat nAChRÃ?2. Extracellular, N-terminus.

Goat Anti-CHRNB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1.

Rabbit Polyclonal Anti-CHRNB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2. Synthetic peptide located within the following region: CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD

Rabbit Polyclonal Anti-CHRNB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV

Rabbit Polyclonal Anti-CHRNB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV

Rabbit polyclonal Anti-CHRNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2. Synthetic peptide located within the following region: KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI

CHRNB2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNB2

CHRNB2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 340-430 of human CHRNB2 (NP_000739.1).
Modifications Unmodified