Antibodies

View as table Download

Rabbit Polyclonal Anti-CHRNG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNG antibody: synthetic peptide directed towards the N terminal of human CHRNG. Synthetic peptide located within the following region: NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY

CHRNG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 328-517 of human CHRNG (NP_005190.4).
Modifications Unmodified