CHRNG Rabbit Polyclonal Antibody

CAT#: TA330432

Rabbit Polyclonal Anti-CHRNG Antibody

Product Images

WB Suggested Anti-CHRNG Antibody; Titration: 1 ug/ml; Positive Control: MCF7 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHRNG antibody: synthetic peptide directed towards the N terminal of human CHRNG. Synthetic peptide located within the following region: NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: cholinergic receptor nicotinic gamma subunit
• Database Link:
  NP_005190
  Entrez Gene 1146 Human
  UniProt ID P07510
• Background: For background information on the acetylcholine receptor (AChR), see CHRNA1. Two forms of AChR are found in mammalian skeletal muscle cells. The mature form is predominant in innervated adult muscle and the embryonic form is present in fetal and denervated muscle. Embryonic and mature AChR differ by the replacement of the gamma subunit in the pentameric glycoprotein complex by its isoform, the epsilon subunit, which is specific to the mature AChR subtype. This switch is mediated by ARIA (acetylcholine receptor-inducing activity.For background information on the acetylcholine receptor (AChR), see CHRNA1 (MIM 100690). Two forms of AChR are found in mammalian skeletal muscle cells. The mature form is predominant in innervated adult muscle and the embryonic form is present in fetal and denervated muscle. Embryonic and mature AChR differ by the replacement of the gamma subunit in the pentameric glycoprotein complex by its isoform, the epsilon subunit (MIM 100725), which is specific to the mature AChR subtype. This switch is mediated by ARIA (acetylcholine receptor-inducing activity; MIM 142445). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2187 AK125362.1 1-2187
• Synonyms: ACHRG
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%; Mouse: 85%; Rat: 85%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane