Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-CIB3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIB3 Antibody: A synthesized peptide derived from human CIB3 |
Antibodies
View as table Download
Rabbit polyclonal anti-CIB3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CIB3. |
Rabbit Polyclonal Anti-CIB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIB3 antibody: synthetic peptide directed towards the N terminal of human CIB3. Synthetic peptide located within the following region: QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG |
Carrier-free (BSA/glycerol-free) CIB3 mouse monoclonal antibody,clone OTI5F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CIB3 mouse monoclonal antibody,clone OTI5F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CIB3 mouse monoclonal antibody,clone OTI5F12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
CIB3 mouse monoclonal antibody,clone OTI5F12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CIB3 mouse monoclonal antibody,clone OTI5F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CIB3