CIB3 Rabbit Polyclonal Antibody

CAT#: TA340232

Rabbit Polyclonal Anti-CIB3 Antibody

Product Images

WB Suggested Anti-CIB3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CIB3 antibody: synthetic peptide directed towards the N terminal of human CIB3. Synthetic peptide located within the following region: QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: calcium and integrin binding family member 3
• Database Link:
  NP_473454
  Entrez Gene 117286 Human
  UniProt ID Q96Q77
• Background: The specific function of CIB3 is not yet known.This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function of this gene is not known. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-635 AB050868.1 1-635 636-661 AW295492.1 15-40 c
• Synonyms: KIP3
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Zebrafish: 93%; Guinea pig: 86%; Horse: 75%

Reference Data

• Protein Families: Druggable Genome