Germany
Japan
United Kingdom
China
CLCNKB (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human CLCNKB |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CLC-K
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KKAISTLTNPPAPK, corresponding to amino acid residues 674-687 of rat longer form CLC-K2L. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-CLCNKB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLCNKB antibody: synthetic peptide directed towards the N terminal of human CLCNKB. Synthetic peptide located within the following region: MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW |
Rabbit Polyclonal Anti-CLCNKB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLCNKB antibody: synthetic peptide directed towards the C terminal of human CLCNKB. Synthetic peptide located within the following region: ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW |
CLCNKB Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLCKB |
Active filters
Target Symbol
- CLCNKB