Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CLNS1A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CLNS1A. |
CLNS1A rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CLNS1A |
CLNS1A (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CLNS1A |
Rabbit Polyclonal Anti-Clns1a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Clns1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA |
CLNS1A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CLNS1A (NP_001284.1). |
| Modifications | Unmodified |
CLNS1A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic Peptide of human CLNS1A |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLNS1A