Clns1a Rabbit Polyclonal Antibody

CAT#: TA340007

Rabbit Polyclonal Anti-Clns1a Antibody

Product Images

WB Suggested Anti-Clns1a Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Clns1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: chloride channel, nucleotide-sensitive, 1A
• Database Link:
  NP_076160
  Entrez Gene 12729 Mouse
• Background: The function of Clns1a remains unknown.
• Synonyms: CLCI; CLNS1B; I(Cln); ICln
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75%