Rabbit Polyclonal Anti-Rsg1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-6330545A04Rik antibody is: synthetic peptide directed towards the N-terminal region of Mouse 6330545A04Rik. Synthetic peptide located within the following region: NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP |
Carrier-free (BSA/glycerol-free) RSG1 mouse monoclonal antibody,clone OTI4H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RSG1 mouse monoclonal antibody,clone OTI4H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RSG1 mouse monoclonal antibody,clone OTI4H7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
RSG1 mouse monoclonal antibody,clone OTI4H7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
RSG1 mouse monoclonal antibody,clone OTI4H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China