Cplane2 Rabbit Polyclonal Antibody

CAT#: TA334368

Rabbit Polyclonal Anti-Rsg1 Antibody

Product Images

Host: Rabbit; Target Name: 6330545A04Rik; Sample Tissue: Mouse Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-6330545A04Rik antibody is: synthetic peptide directed towards the N-terminal region of Mouse 6330545A04Rik. Synthetic peptide located within the following region: NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: REM2 and RAB-like small GTPase 1
• Database Link:
  NP_001074643
  Entrez Gene 76166 Mouse
  UniProt ID A2A825
• Background: 6330545A04Rik has a potential effector of the planar cell polarity signaling pathway. It plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. It is involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia and is more generally involved in exocytosis in secretory cells.
• Synonyms: C1orf89; RP4-733M16.4
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 83%; Zebrafish: 83%