Antibodies

Jump to Filters
View as table Download
CTNNA2 Rabbit Polyclonal Antibody
TA338188

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTNNA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNA2 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNA2. Synthetic peptide located within the following region: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS
CTNNA2 Rabbit Polyclonal Antibody
TA375196

USD 220.00

3 Weeks

CTNNA2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-300 of human CTNNA2 (NP_004380.2).
Modifications Unmodified