CTNNA2 Rabbit Polyclonal Antibody

CAT#: TA338188

Rabbit Polyclonal Anti-CTNNA2 Antibody

Product Images

Host: Rabbit; Target Name: CTNNA2; Sample Tissue: PANC1 Whole cell lysates; Antibody Dilution: 1.0 ug/ml; CTNNA2 is supported by BioGPS gene expression data to be expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTNNA2 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNA2. Synthetic peptide located within the following region: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: catenin alpha 2
• Database Link:
  NP_004380
  Entrez Gene 1496 Human
  UniProt ID P26232
• Background: CTNNA2 may function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. It functions in the control of startle modulation.
• Synonyms: CAP-R; CAPR; CT114; CTNR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rat: 91%; Rabbit: 91%; Zebrafish: 91%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Endometrial cancer, Leukocyte transendothelial migration, Pathways in cancer, Tight junction