Rabbit Polyclonal Anti-CYB561 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYB561 antibody: synthetic peptide directed towards the middle region of human CYB561. Synthetic peptide located within the following region: YRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLH |
Rabbit Polyclonal Anti-CYB561 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYB561 antibody: synthetic peptide directed towards the middle region of human CYB561. Synthetic peptide located within the following region: NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ |
Rabbit Polyclonal Anti-CYB561 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CYB561 antibody is: synthetic peptide directed towards the N-terminal region of Human CYB561. Synthetic peptide located within the following region: GAWLGLYRGGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKR |
Rabbit Polyclonal Anti-CYB561 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYB561 antibody: synthetic peptide directed towards the middle region of human CYB561. Synthetic peptide located within the following region: LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA |
Rabbit Polyclonal CYB561 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Germany
Japan
United Kingdom
China