CYB561 Rabbit Polyclonal Antibody

CAT#: TA346309

Rabbit Polyclonal Anti-CYB561 Antibody

Product Images

Host: Rabbit; Target Name: CYB561; Sample Tissue: 293T Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CYB561 antibody is: synthetic peptide directed towards the N-terminal region of Human CYB561. Synthetic peptide located within the following region: GAWLGLYRGGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: cytochrome b561
• Database Link:
  NP_001017916
  Entrez Gene 1534 Human
  UniProt ID P49447
• Background: The function of this protein remains unknown.
• Synonyms: CYB561A1; FRRS2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%

Reference Data

• Protein Families: Transmembrane