Antibodies

Jump to Filters
View as table Download
CYP4F3 Rabbit Polyclonal Antibody
TA346233

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYP4F3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF
CYP4F3 (N-term) Rabbit Polyclonal Antibody
AP17978PU-N

USD 450.00

2 Weeks

CYP4F3 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CYP4F3