CYP4F3 Rabbit Polyclonal Antibody

CAT#: TA346233

Rabbit Polyclonal Anti-CYP4F3 Antibody

Product Images

WB Suggested Anti-CYP4F3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysateCYP4F3 is supported by BioGPS gene expression data to be expressed in OVCAR3

• 

  Rabbit Anti-CYP4F3 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, moderate tissue distribution; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X; Exposure Time: 0.5–2.0 sec; Protocol located in Reviews and Data.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: cytochrome P450 family 4 subfamily F member 3
• Database Link:
  NP_000887
  Entrez Gene 4051 Human
  UniProt ID Q08477
• Background: This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F8, is approximately 18 kb away. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
• Synonyms: CPF3; CYP4F; LTB4H
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 85%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome, P450, Transmembrane
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways