Antibodies

Jump to Filters
View as table Download
CAPS1 (CADPS) Rabbit Polyclonal Antibody
TA306560

USD 430.00

5 Days

Rabbit Polyclonal CAPS1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CAPS1 antibody was raised against a 20 amino acid peptide near the carboxy terminus of the human CAPS1.
CAPS1 (CADPS) Rabbit Polyclonal Antibody
TA306561

USD 430.00

5 Days

Rabbit Polyclonal CAPS1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CAPS1 antibody was raised against a 21 amino acid peptide near the amino terminus of the human CAPS1.
CAPS1 (CADPS) (C-term) Rabbit Polyclonal Antibody
AP23464PU-N

USD 440.00

2 Weeks

CAPS1 (CADPS) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, 20 amino acid peptide near the carboxy terminus of the human CAPS1
CAPS1 (CADPS) (N-term) Rabbit Polyclonal Antibody
AP23465PU-N

USD 525.00

2 Weeks

CAPS1 (CADPS) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, 21 amino acid peptide near the amino terminus of the human CAPS1
CAPS1 (CADPS) Rabbit Polyclonal Antibody
TA342634

USD 375.00

5 Days

Rabbit Polyclonal Anti-CADPS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CADPS antibody is: synthetic peptide directed towards the N-terminal region of Human CADPS. Synthetic peptide located within the following region: RFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRA
CAPS1 (CADPS) Rabbit Polyclonal Antibody
TA357602

USD 360.00

5 Days

CADPS Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAPS1
CAPS1 (CADPS) Rabbit Polyclonal Antibody
TA374206

USD 220.00

3 Weeks

CADPS Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1020-1100 of human CADPS (NP_899630.1).
Modifications Unmodified