Antibodies

View as table Download

CAMSAP3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAMSAP3

Rabbit Polyclonal Anti-CAMSAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CAMSAP3 Antibody is: synthetic peptide directed towards the C-terminal region of Human CAMSAP3. Synthetic peptide located within the following region: APSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSN

CAMSAP3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAMSAP3