Antibodies

Jump to Filters
View as table Download
TIP120B (CAND2) Rabbit Polyclonal Antibody
TA339710

USD 375.00

5 Days

Rabbit Polyclonal Anti-CAND2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAND2 antibody: synthetic peptide directed towards the N terminal of human CAND2. Synthetic peptide located within the following region: MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVV
TIP120B (CAND2) Rabbit Polyclonal Antibody
TA374241

USD 220.00

3 Weeks

CAND2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1).
Modifications Unmodified