TIP120B (CAND2) Rabbit Polyclonal Antibody

CAT#: TA339710

Rabbit Polyclonal Anti-CAND2 Antibody

Product Images

WB Suggested Anti-CAND2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAND2 antibody: synthetic peptide directed towards the N terminal of human CAND2. Synthetic peptide located within the following region: MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 123 kDa
• Gene Name: cullin associated and neddylation dissociated 2 (putative)
• Database Link:
  NP_036430
  Entrez Gene 23066 Human
  UniProt ID O75155
• Background: CAND2 may play a role in the assembly of ubiquitin ligase complexes and modulate the ubiquitination of target proteins. And it may be also a transcription regulator.
• Synonyms: TIP120B; Tp120b
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%