Rabbit Polyclonal Anti-C9orf41 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C9orf41 Antibody is: synthetic peptide directed towards the middle region of Human C9orf41. Synthetic peptide located within the following region: DGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKN |
Carrier-free (BSA/glycerol-free) C9orf41 mouse monoclonal antibody, clone OTI6A2 (formerly 6A2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
C9orf41 mouse monoclonal antibody, clone OTI6A2 (formerly 6A2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
C9orf41 mouse monoclonal antibody, clone OTI6A2 (formerly 6A2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
C9orf41 mouse monoclonal antibody, clone OTI6A2 (formerly 6A2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
C9orf41 mouse monoclonal antibody, clone OTI6A2 (formerly 6A2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
