Antibodies

Jump to Filters
View as table Download
CBR4 Rabbit Polyclonal Antibody
TA343017

USD 375.00

5 Days

Rabbit Polyclonal Anti-CBR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBR4 antibody: synthetic peptide directed towards the N terminal of human CBR4. Synthetic peptide located within the following region: RKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH
CBR4 Mouse Monoclonal Antibody [Clone ID: OTI3C10]
CF810992

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CBR4 mouse monoclonal antibody,clone OTI3C10

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CBR4 Rabbit Polyclonal Antibody
TA357720

USD 360.00

5 Days

CBR4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
CBR4 Rabbit Polyclonal Antibody
TA365344

USD 380.00

4 Weeks

CBR4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
CBR4 Rabbit Polyclonal Antibody
TA369662

USD 380.00

4 Weeks

CBR4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
CBR4 Rabbit Polyclonal Antibody
TA374321

USD 220.00

3 Weeks

CBR4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CBR4 (NP_116172.2).
Modifications Unmodified
CBR4 Mouse Monoclonal Antibody [Clone ID: OTI3C10]
TA810992

USD 379.00

In Stock

CBR4 mouse monoclonal antibody,clone OTI3C10

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CBR4 Mouse Monoclonal Antibody [Clone ID: OTI3C10]
TA810992S

USD 159.00

2 Days

CBR4 mouse monoclonal antibody,clone OTI3C10

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated