CBR4 Rabbit Polyclonal Antibody

CAT#: TA343017

Rabbit Polyclonal Anti-CBR4 Antibody

Product Images

WB Suggested Anti-CBR4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CBR4 antibody: synthetic peptide directed towards the N terminal of human CBR4. Synthetic peptide located within the following region: RKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: carbonyl reductase 4
• Database Link:
  NP_116172
  Entrez Gene 84869 Human
  UniProt ID Q8N4T8
• Background: The heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria. The homotetramer may act as NADPH-dependent quinone reductase. It has broad substrate specificity and reduces 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones (in vitro).
• Synonyms: SDR45C1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome