Antibodies

Jump to Filters
View as table Download
Ccnb1ip1 Rabbit Polyclonal Antibody
TA344340

USD 475.00

5 Days

Rabbit Polyclonal Anti-Ccnb1ip1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ccnb1ip1 antibody is synthetic peptide directed towards the N-terminal region of Mouse Ccnb1ip1. Synthetic peptide located within the following region: CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS
CCNB1IP1 (C-term) Rabbit Polyclonal Antibody
AP50808PU-N

USD 450.00

2 Weeks

CCNB1IP1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human CCNB1IP1
CCNB1IP1 Rabbit Polyclonal Antibody
TA312550

USD 345.00

In Stock

Rabbit polyclonal anti-CCNB1IP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CCNB1IP1.
CCNB1IP1 Mouse Monoclonal Antibody [Clone ID: OTI4H3]
CF502700

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CCNB1IP1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CCNB1IP1 Rabbit Polyclonal Antibody
TA365599

USD 380.00

4 Weeks

CCNB1IP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
CCNB1IP1 Rabbit Polyclonal Antibody
TA369920

USD 380.00

4 Weeks

CCNB1IP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
CCNB1IP1 Rabbit Polyclonal Antibody
TA374367

USD 220.00

3 Weeks

CCNB1IP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CCNB1IP1.
CCNB1IP1 Mouse Monoclonal Antibody [Clone ID: OTI4H3]
TA502700

USD 379.00

In Stock

CCNB1IP1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CCNB1IP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H3]
TA502700AM

USD 420.00

4 Weeks

CCNB1IP1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
CCNB1IP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H3]
TA502700BM

USD 420.00

4 Weeks

CCNB1IP1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
CCNB1IP1 Mouse Monoclonal Antibody [Clone ID: OTI4H3]
TA502700S

USD 159.00

In Stock

CCNB1IP1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated