Antibodies

View as table Download

Rabbit polyclonal anti-Cyclin-L1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin-L1.

Rabbit Polyclonal Anti-Cyclin L1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cyclin L1 Antibody: A synthesized peptide derived from human Cyclin L1

Rabbit Polyclonal Anti-CCNL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCNL1 Antibody: synthetic peptide directed towards the N terminal of human CCNL1. Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD

Ccnl1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated