Rabbit polyclonal anti-Cyclin-L1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin-L1. |
Rabbit polyclonal anti-Cyclin-L1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin-L1. |
Rabbit Polyclonal Anti-Cyclin L1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cyclin L1 Antibody: A synthesized peptide derived from human Cyclin L1 |
Rabbit Polyclonal Anti-CCNL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CCNL1 Antibody: synthetic peptide directed towards the N terminal of human CCNL1. Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD |
Ccnl1 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |