CCNL1 Rabbit Polyclonal Antibody

CAT#: TA331832

Rabbit Polyclonal Anti-CCNL1 Antibody

Product Images

WB Suggested Anti-CCNL1 Antibody Titration: 2.5ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysateCCNL1 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCNL1 Antibody: synthetic peptide directed towards the N terminal of human CCNL1. Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: cyclin L1
• Database Link:
  NP_064703
  Entrez Gene 57018 Human
  UniProt ID Q9UK58
• Background: CCNL1 plays a critical role in the loco-regional progression of HNSCC and may serve as an indicator for occult advanced tumour stages. CCNL1 also plays a role in pre-mRNA splicing, has been shown to associate with the PITSLRE kinase, and is involved in pre-mRNA processing.
• Synonyms: ania-6a; ANIA6A; BM-001; PRO1073
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 92%

Reference Data

• Protein Families: Druggable Genome