Antibodies

View as table Download

CCNL2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 345-374 amino acids from the Central region of human CCNL2

Rabbit polyclonal RAT Ccnl2 Antibody (C-term)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen This RAT Ccnl2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 422-450 amino acids from the C-terminal region of rat Ccnl2.

Rabbit Polyclonal Anti-CCNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNL2 antibody: synthetic peptide directed towards the N terminal of human CCNL2. Synthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR

Cyclin L2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-150 of human Cyclin L2 (NP_001307082.1).
Modifications Unmodified