Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CD200R1 (MOX2R) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MOX2R. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CD200R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200R1 antibody: synthetic peptide directed towards the N terminal of human CD200R1. Synthetic peptide located within the following region: NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL |
Rabbit Polyclonal Anti-CD200R1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CD200R1 |
CD200R1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CD200R1 |
CD200R1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 249-348 of human CD200R1 (NP_620161.1). |
| Modifications | Unmodified |
Recombinant Anti-CD200R (Clone OX108)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-CD200R (Clone OX108)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- CD200R1