Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-CD226/DNAM-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD226/DNAM-1 Antibody: A synthesized peptide derived from human CD226/DNAM-1 |
Antibodies
View as table Download
Rabbit polyclonal CD226/DNAM-1 (Ab-329) antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CD226/DNAM-1 around the phosphorylation site of serine 329 (T-F-SP-R-R). |
Rabbit Polyclonal Anti-CD226 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD226 antibody is: synthetic peptide directed towards the C-terminal region of Human CD226. Synthetic peptide located within the following region: QASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIF |
Cd226 rat monoclonal antibody, clone 15F.10E5, FITC
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | FITC |
Cd226 rat monoclonal antibody, clone 15F.10E5, Purified
| Applications | FC |
| Reactivities | Mouse |
CD226 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD226 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C region of human CD226 |
CD226 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD226 |
CD226 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD226 |
CD226 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-254 of human CD226 (NP_006557.2). |
| Modifications | Unmodified |
Recombinant Anti-CD226 (Clone 10E5)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD226 (Clone 10E5)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CD226