Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CD300LF (CLM-1) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLM-1. |
Rabbit Polyclonal Anti-CD300LF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CD300LF antibody is: synthetic peptide directed towards the middle region of Human CD300LF. Synthetic peptide located within the following region: IWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYW |
CD300LF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CD300LF (NP_001276011.1). |
| Modifications | Unmodified |
CD300LF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CD300LF (NP_001276011.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CD300LF