CD300 (CD300LF) Rabbit Polyclonal Antibody

CAT#: TA330859

Rabbit Polyclonal Anti-CD300LF Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CD300LF"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CD300LF antibody is: synthetic peptide directed towards the middle region of Human CD300LF. Synthetic peptide located within the following region: IWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name CD300 molecule like family member f
Background CD300LF is an inhibitory receptor of the Ig superfamily expressed on myeloid cells. It mediates negative regulatory signals by recruiting SHP1 or SHIP.
Synonyms CD300f; CLM-1; CLM1; IgSF13; IREM-1; IREM1; LMIR3; NKIR
Note Human: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.