Rabbit Polyclonal Anti-CDK5RAP1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cdk5rap1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD |
Rabbit Polyclonal Anti-CDK5RAP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK5RAP1 antibody: synthetic peptide directed towards the N terminal of human CDK5RAP1. Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI |
CDK5RAP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDK5RAP1 |
CDK5RAP1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human CDK5RAP1 (NP_057492.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China