Antibodies

View as table Download

Lass5 (CERS5) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen LASS5 antibody was raised against lASS5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human LASS5.

Rabbit Polyclonal LASS5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 18 amino acid peptide near the amino terminus of the human LASS5.

Rabbit Polyclonal Anti-LASS5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LASS5 Antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: CALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRK

Rabbit Polyclonal LASS5 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human LASS5.

Rabbit Polyclonal LASS5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 14 amino acid peptide near the amino terminus of the human LASS5.

Rabbit Polyclonal Anti-LASS5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LASS5 antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: PCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR

Rabbit Polyclonal Anti-CERS5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CERS5

CERS5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CERS5

CERS5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CERS5 (NP_001268660.1).

CERS5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CERS5 (NP_001268660.1).