Lass5 (CERS5) Rabbit Polyclonal Antibody

CAT#: TA331637

Rabbit Polyclonal Anti-LASS5 Antibody

Product Images

WB Suggested Anti-LASS5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Pancreas

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LASS5 Antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: CALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: ceramide synthase 5
• Database Link:
  NP_671723
  Entrez Gene 91012 Human
  UniProt ID Q8N5B7
• Background: LASS5 may be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When it is overexpressed in cells it is involved in the production of sphingolipids containing mainly only one fatty acid donor (N-linked palmitoyl- (C16) ceramide) in a fumonisin B1-independent manner
• Synonyms: LASS5; Trh4
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 86%; Dog: 79%; Rat: 79%

Reference Data

• Protein Families: Transcription Factors, Transmembrane