Antibodies

View as table Download

Mouse Monoclonal CHAF1B Antibody (SS 24 1-68)

Applications WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Rabbit polyclonal anti-CAF1B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CAF1B.

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the C terminal of human CHAF1B. Synthetic peptide located within the following region: PPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP

Mouse Monoclonal Antibody against CAF-1 p60 (SS 53)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the N terminal of human CHAF1B. Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD

Carrier-free (BSA/glycerol-free) CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHAF1B mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

p60 CAF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-559 of human p60 CAF1 (NP_005432.1).
Modifications Unmodified

CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated