Antibodies

View as table Download

Rabbit anti-CHMP2B Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CHMP2B

Rabbit Polyclonal Anti-Chmp2b Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Chmp2b antibody is: synthetic peptide directed towards the N-terminal region of Rat Chmp2b. Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK

CHMP2B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CHMP2B

CHMP2B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CHMP2B

CHMP2B Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-213 of human CHMP2B (NP_054762.2).
Modifications Unmodified