Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against CHRNB3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SRHVKKEHFISQ, from the internal region of the protein sequence according to NP_000740.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CHRNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3. Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY |
CHRNB3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACHB3 |
CHRNB3 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CHRNB3 |
CHRNB3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-232 of human CHRNB3 (NP_000740.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CHRNB3