Antibodies

Jump to Filters
View as table Download
CHST15 Rabbit Polyclonal Antibody
TA341985

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GALNAC4S-6ST Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNAC4S-6ST antibody: synthetic peptide directed towards the middle region of human GALNAC4S-6ST. Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
CHST15 Rabbit Polyclonal Antibody
TA374788

USD 220.00

3 Weeks

CHST15 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 452-561 of human CHST15 (NP_056976.2).
Modifications Unmodified